Structure of PDB 8f15 Chain A Binding Site BS01

Receptor Information
>8f15 Chain A (length=133) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GASPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCY
LKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRA
YSLAKEQRLNFGDDIPSALRIAKKKRWNSIEER
Ligand information
>8f15 Chain D (length=14) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PWWECLSQADDCDF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8f15 Single-Shot Flow Synthesis of D-Proteins for Mirror-Image Phage Display
Resolution1.73 Å
Binding residue
(original residue number in PDB)
K30 N34 V61 N65 K95 F98 Q102 L105 F131 D134 I135 S137 A138
Binding residue
(residue number reindexed from 1)
K10 N14 V41 N45 K75 F78 Q82 L85 F111 D114 I115 S117 A118
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:8f15, PDBe:8f15, PDBj:8f15
PDBsum8f15
PubMed
UniProtQ9UNE7|CHIP_HUMAN E3 ubiquitin-protein ligase CHIP (Gene Name=STUB1)

[Back to BioLiP]