Structure of PDB 8f14 Chain A Binding Site BS01

Receptor Information
>8f14 Chain A (length=132) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GASPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCY
LKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRA
YSLAKEQRLNFGDDIPSALRIAKKKRWNSIEE
Ligand information
>8f14 Chain B (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PWEDCAWFAWACYNI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8f14 Single-Shot Flow Synthesis of D-Proteins for Mirror-Image Phage Display
Resolution1.69 Å
Binding residue
(original residue number in PDB)		N34 F37 N65 L68 K72 K95 F98 F99 Q102 N130 F131
Binding residue
(residue number reindexed from 1)		N14 F17 N45 L48 K52 K75 F78 F79 Q82 N110 F111
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:8f14, PDBe:8f14, PDBj:8f14
PDBsum8f14
PubMed
UniProtQ9UNE7|CHIP_HUMAN E3 ubiquitin-protein ligase CHIP (Gene Name=STUB1)

[Back to BioLiP]