Structure of PDB 8ey7 Chain A Binding Site BS01

Receptor Information
>8ey7 Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHHHSQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASF
HRVQALTTDISLIFAALKDSKVVEIVDEKVRRREEPEKWPLPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ey7 Structural insights into poly(A) tail stabilization via 3'-end guanylation
Resolution1.35 Å
Binding residue
(original residue number in PDB)		Q333 Y336 Y337 D346 F348 L349 S366 F367 H368 R369
Binding residue
(residue number reindexed from 1)		Q16 Y19 Y20 D29 F31 L32 S49 F50 H51 R52
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8ey7, PDBe:8ey7, PDBj:8ey7
PDBsum8ey7
PubMed
UniProtQ6PKG0|LARP1_HUMAN La-related protein 1 (Gene Name=LARP1)

[Back to BioLiP]