Structure of PDB 8ey6 Chain A Binding Site BS01

Receptor Information
>8ey6 Chain A (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRVQ
ALTTDISLIFAALKDSKVVEIVDEKVRRREEPEKWPLPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ey6 Structural insights into poly(A) tail stabilization via 3'-end guanylation
Resolution1.63 Å
Binding residue
(original residue number in PDB)		Q333 Y336 Y337 D346 F348 L349 S366 F367 H368 R369
Binding residue
(residue number reindexed from 1)		Q12 Y15 Y16 D25 F27 L28 S45 F46 H47 R48
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8ey6, PDBe:8ey6, PDBj:8ey6
PDBsum8ey6
PubMed
UniProtQ6PKG0|LARP1_HUMAN La-related protein 1 (Gene Name=LARP1)

[Back to BioLiP]