Structure of PDB 8esb Chain A Binding Site BS01

Receptor Information

>8esb Chain A (length=273) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGCYNQSEAGSHTVQRMYG
CDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAA
HVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEAT
LRCWALSFYPAEITLTWQRDGEDQTELVETRPAGDGTFQKWAAVVVPSGQ
EQRYTCHVQHEGLPKPLTLRWEP

Ligand information

>8esb Chain C (length=12) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GLYDGREHSVGC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8esb Structural analysis of cancer-relevant TCR-CD3 and peptide-MHC complexes by cryoEM
Resolution	3.12 Å
Binding residue (original residue number in PDB)	Y7 K66 V67 T73 D77 C84 R97 Y99 T143 K146 W147 V152 Y159
Binding residue (residue number reindexed from 1)	Y7 K66 V67 T73 D77 C84 R97 Y99 T143 K146 W147 V152 Y159

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response

	Cellular Component
GO:0042612	MHC class I protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8esb, PDBe:8esb, PDBj:8esb
PDBsum	8esb
PubMed	37100770
UniProt	Q53Z42

[Back to BioLiP]