Structure of PDB 8eqs Chain A Binding Site BS01

Receptor Information
>8eqs Chain A (length=192) Species: 2901879 (Severe acute respiratory syndrome coronavirus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLPFGWLVIGVAFLAVFQSATKIIALNKRWQLALYKGFQFICNLLLLFVT
IYSHLLLVAAGMEAQFLYLYALIYFLQCINACRIIMRCWLCWKCKSKNPL
LYDANYFVCWHTHNYDYCIPYNSVTDTIVVTEGDGKEDYQIGGYSEDRHS
GVKDYVVVHGYFTEVYYQLESTQITTDTGIENATFFIFNKLV
Ligand information
>8eqs Chain D (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FSKLREQLGPVTQEFWDNLEKETEGLR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8eqs The SARS-CoV-2 accessory protein Orf3a is not an ion channel, but does interact with trafficking proteins.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		W128 F207
Binding residue
(residue number reindexed from 1)		W89 F162
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005216 monoatomic ion channel activity
GO:0005515 protein binding
GO:0015267 channel activity
GO:0042802 identical protein binding
Biological Process
GO:0006915 apoptotic process
GO:0019049 virus-mediated perturbation of host defense response
GO:0034220 monoatomic ion transmembrane transport
GO:0039502 symbiont-mediated suppression of host type I interferon-mediated signaling pathway
GO:0052170 symbiont-mediated suppression of host innate immune response
GO:0098662 inorganic cation transmembrane transport
Cellular Component
GO:0005576 extracellular region
GO:0005886 plasma membrane
GO:0005891 voltage-gated calcium channel complex
GO:0008076 voltage-gated potassium channel complex
GO:0016020 membrane
GO:0020002 host cell plasma membrane
GO:0030430 host cell cytoplasm
GO:0044177 host cell Golgi apparatus
GO:0044178 host cell Golgi membrane
GO:0044423 virion component
GO:0055036 virion membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8eqs, PDBe:8eqs, PDBj:8eqs
PDBsum8eqs
PubMed36695574
UniProtP59632|AP3A_SARS ORF3a protein (Gene Name=3a)

[Back to BioLiP]