Structure of PDB 8eo8 Chain A Binding Site BS01

Receptor Information
>8eo8 Chain A (length=275) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPW
IEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGC
DLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAR
VAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATL
RCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPS
GEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8eo8 Molecular determinants of cross-strain influenza A virus recognition by T-cell receptors
Resolution2.3 Å
Binding residue
(original residue number in PDB)
Y7 R62 N63 I66 E76 S77 N80 Y84 Y99 Y123 T143 K146 W147 V152 Q155 L156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y6 R61 N62 I65 E75 S76 N79 Y83 Y98 Y122 T142 K145 W146 V151 Q154 L155 Y158 W166 Y170
Enzymatic activity
Enzyme Commision number ?
External links