Structure of PDB 8elh Chain A Binding Site BS01

Receptor Information
>8elh Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAP
WIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYG
CDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
REAEQWRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
>8elh Chain C (length=9) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NQKLIANQF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8elh A common allele of HLA is associated with asymptomatic SARS-CoV-2 infection.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		Y7 Y9 M45 R62 E63 N70 T73 E76 S77 N80 Y84 R97 Y99 S116 T143 W147 E152 W156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 Y9 M45 R62 E63 N70 T73 E76 S77 N80 Y84 R97 Y99 S116 T143 W147 E152 W156 Y159 W167 Y171
External links