Structure of PDB 8ek5 Chain A Binding Site BS01

Receptor Information
>8ek5 Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFG
CDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAA
HVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ek5 Structural principles of peptide-centric Chimeric Antigen Receptor recognition guide therapeutic expansion.
Resolution2.11 Å
Binding residue
(original residue number in PDB)		Y8 E64 K67 V68 A70 H71 T74 N78 I81 Y85 F100 Y117 Y124 T144 K147 W148 Y160 Y172
Binding residue
(residue number reindexed from 1)		Y7 E63 K66 V67 A69 H70 T73 N77 I80 Y84 F99 Y116 Y123 T143 K146 W147 Y159 Y171
Enzymatic activity
Enzyme Commision number ?
External links