Structure of PDB 8ek1 Chain A Binding Site BS01

Receptor Information
>8ek1 Chain A (length=118) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVKLVESGGGVVQPGRSLRLSCEASGFIFSTYGMHWVRQAPGKGLEWVAV
IWFDGSNIYYADSVKGRFTISRDNSKNTVFMQMDSLRAEDTAVYYCHRNF
YDGSGPFDYWGQGTLVTV
Ligand information
>8ek1 Chain P (length=27) Species: 36329 (Plasmodium falciparum 3D7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NANPNVDPNANPNVDPNANPNVDPNAN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ek1 Cryo-EM structures of anti-malarial antibody L9 with circumsporozoite protein reveal trimeric L9 association and complete 27-residue epitope.
Resolution3.6 Å
Binding residue
(original residue number in PDB)
Y32 W52 Y101
Binding residue
(residue number reindexed from 1)
Y32 W52 Y101
External links