Structure of PDB 8ejp Chain A Binding Site BS01

Receptor Information
>8ejp Chain A (length=56) Species: 9258 (Ornithorhynchus anatinus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARRKRTTFNKTQLEILVKSFNKDPYPGIGVREHLASLIQIPESRIQVWFQ
NRRARQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ejp Antagonism among DUX family members evolved from an ancestral toxic single homeodomain protein.
Resolution2.174 Å
Binding residue
(original residue number in PDB)
R23 R25 T26 F28 R64 W68 N71 R75
Binding residue
(residue number reindexed from 1)
R3 R5 T6 F8 R44 W48 N51 R55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:8ejp, PDBe:8ejp, PDBj:8ejp
PDBsum8ejp
PubMed37744032
UniProtA0A6I8NF41

[Back to BioLiP]