Structure of PDB 8ebu Chain A Binding Site BS01

Receptor Information
>8ebu Chain A (length=604) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLV
AIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDG
IMQFIKLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRN
SEGEATETVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINID
LKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRK
RCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAIST
YSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQ
AHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAE
VWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKII
VFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISK
VGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRYNAFFYSLVSQDTQ
EMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLA
ATDL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ebu Lesion recognition by XPC, TFIIH and XPA in DNA excision repair.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		S367 A368 T393 S394 S411 M412 H415 K418 S420 D563 V565 Y581 R589 S608 K609
Binding residue
(residue number reindexed from 1)		S258 A259 T284 S285 S302 M303 H306 K309 S311 D454 V456 Y472 R480 S499 K500
Enzymatic activity
Enzyme Commision number 5.6.2.4: DNA 3'-5' helicase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003678 DNA helicase activity
GO:0003684 damaged DNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0016853 isomerase activity
GO:0016887 ATP hydrolysis activity
GO:0043138 3'-5' DNA helicase activity
GO:1990841 promoter-specific chromatin binding
Biological Process
GO:0000717 nucleotide-excision repair, DNA duplex unwinding
GO:0001666 response to hypoxia
GO:0006265 DNA topological change
GO:0006281 DNA repair
GO:0006283 transcription-coupled nucleotide-excision repair
GO:0006289 nucleotide-excision repair
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006368 transcription elongation by RNA polymerase II
GO:0006915 apoptotic process
GO:0006979 response to oxidative stress
GO:0008104 protein localization
GO:0009411 response to UV
GO:0009650 UV protection
GO:0035315 hair cell differentiation
GO:0043065 positive regulation of apoptotic process
GO:0048568 embryonic organ development
GO:1901990 regulation of mitotic cell cycle phase transition
Cellular Component
GO:0000112 nucleotide-excision repair factor 3 complex
GO:0000439 transcription factor TFIIH core complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005669 transcription factor TFIID complex
GO:0005675 transcription factor TFIIH holo complex
GO:0097550 transcription preinitiation complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ebu, PDBe:8ebu, PDBj:8ebu
PDBsum8ebu
PubMed37076618
UniProtP19447|ERCC3_HUMAN General transcription and DNA repair factor IIH helicase/translocase subunit XPB (Gene Name=ERCC3)

[Back to BioLiP]