Structure of PDB 8ebb Chain A Binding Site BS01

Receptor Information
>8ebb Chain A (length=169) Species: 59765 (Fusarium oxysporum f. sp. lycopersici) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTLPVSTCPAGQKYDRSVCYKADKIRSFCVANPRSNREKITDTPCQPREI
CVQRNLSNGKSFAKCIPIVDLVEWKTSANGNKEGCTTTSVNPAGYHHLGT
IVYDINKNPIEVDKISYFGEPGNVNEGIGGSTSYFSSDNFQFSKSRYMKT
CIFSGGYGNLNAYTWSWES
Ligand information
>8ebb Chain C (length=18) Species: 59765 (Fusarium oxysporum f. sp. lycopersici) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VAEHTINYIDIAPEEFEP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ebb MX2: a high-flux undulator microfocus beamline serving both the chemical and macromolecular crystallography communities at the Australian Synchrotron.
Resolution1.88 Å
Binding residue
(original residue number in PDB)		P61 S63 Y71 R111 L113 F119 K121 V129 T143 T144 T145 S146 V147 N148 H153 S223 W224 E225 S226
Binding residue
(residue number reindexed from 1)		P4 S6 Y14 R54 L56 F62 K64 V72 T86 T87 T88 S89 V90 N91 H96 S166 W167 E168 S169
Enzymatic activity
Enzyme Commision number ?
External links