Structure of PDB 8eb5 Chain A Binding Site BS01

Receptor Information

>8eb5 Chain A (length=74) Species: 7370 (Musca domestica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MDNLEVKAKINQGLYKITPRHKGTSFIWNVLADIQKEDDTLVEGWVFCRK
CEKVLKYTTRQTSNLCRHKCCASL

Ligand information

>8eb5 Chain C (length=17) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

caacaagtggcttattt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8eb5 Zinc-finger BED domains drive the formation of the active Hermes transpososome by asymmetric DNA binding.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	K56 R63 Q64 R70 H71 K72
Binding residue (residue number reindexed from 1)	K53 R60 Q61 R67 H68 K69

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:8eb5, PDBe:8eb5, PDBj:8eb5
PDBsum	8eb5
PubMed	37491363
UniProt	Q25442

[Back to BioLiP]