Structure of PDB 8e9a Chain A Binding Site BS01

Receptor Information
>8e9a Chain A (length=175) Species: 10498 (African swine fever virus BA71V) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLND
VDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQL
DLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLV
PLKITTEKELIKELGFTYRIPKKRL
Ligand information
>8e9a Chain C (length=48) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gctgggatacattgtgcgcacaatgggctagctacaacgaatcccagc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e9a Structure of a 10-23 deoxyribozyme exhibiting a homodimer conformation.
Resolution2.69 Å
Binding residue
(original residue number in PDB)
D49 D51 C81 G82 E83 R84 K85 H115 F116 G118 V120 I124 R127 K131 K136 Y140
Binding residue
(residue number reindexed from 1)
D50 D52 C82 G83 E84 R85 K86 H116 F117 G119 V121 I125 R128 K132 K137 Y141
Enzymatic activity
Enzyme Commision number 2.7.7.7: DNA-directed DNA polymerase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003887 DNA-directed DNA polymerase activity
GO:0016779 nucleotidyltransferase activity
GO:0046872 metal ion binding
Biological Process
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006303 double-strand break repair via nonhomologous end joining
GO:0071897 DNA biosynthetic process
Cellular Component
GO:0044423 virion component

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8e9a, PDBe:8e9a, PDBj:8e9a
PDBsum8e9a
PubMed37301907
UniProtP42494|DPOLX_ASFB7 Repair DNA polymerase X (Gene Name=Ba71V-97)

[Back to BioLiP]