Structure of PDB 8e8i Chain A Binding Site BS01

Receptor Information
>8e8i Chain A (length=275) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAP
WIEQEGPEYWDRNTQIFKTNTQTDRCSLRNLRGYYNQSEAGSHTLQSMYG
CDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAA
RVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWE
Ligand information
>8e8i Chain C (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FVKKKYCL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e8i Structures of HLA-B8E76C loaded with long peptides reveal novel features at the N-terminus of the groove
Resolution1.49 Å
Binding residue
(original residue number in PDB)		Y7 D9 R62 N63 I66 F67 N70 T73 D74 C76 S77 N80 Y84 S97 Y99 Y123 T143 K146 W147 V152 Q155 D156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 D9 R62 N63 I66 F67 N70 T73 D74 C76 S77 N80 Y84 S97 Y99 Y123 T143 K146 W147 V152 Q155 D156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links