Structure of PDB 8e5e Chain A Binding Site BS01

Receptor Information
>8e5e Chain A (length=134) Species: 95486 (Burkholderia cenocepacia) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSYALGPYQISAPQLPAYNGQTVGTFYYVNDAGGLESKVFSSGGPTPYPN
YANAGHVAGQSALFMRDNGISEGLVFHNNPEGTCGFCVNMTETLLPENAK
MTVVPPEGAIPVKRGATGETKVFTGNSNSPKSPH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e5e Structural basis of sequence-specific cytosine deamination by double-stranded DNA deaminase toxin DddA.
Resolution2.62 Å
Binding residue
(original residue number in PDB)
N1339 Y1340 A1341 N1378 M1379 R1403 K1420
Binding residue
(residue number reindexed from 1)
N50 Y51 A52 N89 M90 R114 K131
Enzymatic activity
Enzyme Commision number 3.5.4.-
External links
PDB RCSB:8e5e, PDBe:8e5e, PDBj:8e5e
PDBsum8e5e
PubMed37460895
UniProtP0DUH5|DDDA_BURC1 Double-stranded DNA deaminase toxin A (Gene Name=dddA)

[Back to BioLiP]