Structure of PDB 8e3e Chain A Binding Site BS01

Receptor Information
>8e3e Chain A (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHMR
KHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDH
LHRHLKKDGCN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e3e Structural basis for transcription factor ZBTB7A recognition of DNA and effects of ZBTB7A somatic mutations that occur in human acute myeloid leukemia.
Resolution2.99 Å
Binding residue
(original residue number in PDB)		K389 I391 Q392 G393 K396 R399 T403 K408 T420 R421 K424 R464 K473 R477 H480 R483
Binding residue
(residue number reindexed from 1)		K9 I11 Q12 G13 K16 R19 T23 K28 T40 R41 K44 R84 K93 R97 H100 R103
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8e3e, PDBe:8e3e, PDBj:8e3e
PDBsum8e3e
PubMed36626981
UniProtO95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)

[Back to BioLiP]