Structure of PDB 8e2z Chain A Binding Site BS01

Receptor Information
>8e2z Chain A (length=269) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAP
WIEWDRNTQIFKTNTQTDRCSLRNLRGYYNQSEAGSHTLQSMYGCDVGPD
GRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQD
RAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWAL
GFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQR
YTCHVQHEGLPKPLTLRWE
Ligand information
>8e2z Chain C (length=9) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AFAKKKYCL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e2z Structures of HLA-B8E76C loaded with long peptides reveal novel features at the N-terminus of the groove
Resolution1.13 Å
Binding residue
(original residue number in PDB)		Y7 D9 N63 I66 F67 N70 T73 D74 C76 S77 N80 Y84 S97 Y99 Y123 T143 K146 W147 V152 Q155 D156 Y159 W167
Binding residue
(residue number reindexed from 1)		Y7 D9 N57 I60 F61 N64 T67 D68 C70 S71 N74 Y78 S91 Y93 Y117 T137 K140 W141 V146 Q149 D150 Y153 W161
Enzymatic activity
Enzyme Commision number ?
External links