Structure of PDB 8e2q Chain A Binding Site BS01

Receptor Information
>8e2q Chain A (length=154) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VEFSHEYWMRHALALAKRARDEREVPVGAVLVLNNRVIGEGWNRGIGLHD
PTAHAEIMALRQGGLVMQNYRLYDATLYTTFEPCVMCAGAMIHSRIGRVV
FGVRNAKTGAAGSLMDVLHHPGMNHRVEITEGILADECEALLCRFFRMPR
RVFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e2q Improved cytosine base editors generated from TadA variants.
Resolution2.34 Å
Binding residue
(original residue number in PDB)		V30 N46 H57 E59 C87 N108 K110 F148 F149 R150 M151 P152 V155 F156 N157
Binding residue
(residue number reindexed from 1)		V27 N43 H54 E56 C84 N105 K107 F145 F146 R147 M148 P149 V152 F153 N154
Enzymatic activity
Enzyme Commision number 3.5.4.33: tRNA(adenine(34)) deaminase.
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0008251 tRNA-specific adenosine deaminase activity
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0052717 tRNA-specific adenosine-34 deaminase activity
Biological Process
GO:0002100 tRNA wobble adenosine to inosine editing
GO:0006382 adenosine to inosine editing
GO:0008033 tRNA processing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8e2q, PDBe:8e2q, PDBj:8e2q
PDBsum8e2q
PubMed36624149
UniProtP68398|TADA_ECOLI tRNA-specific adenosine deaminase (Gene Name=tadA)

[Back to BioLiP]