Structure of PDB 8e2c Chain A Binding Site BS01

Receptor Information
>8e2c Chain A (length=65) Species: 93062 (Staphylococcus aureus subsp. aureus COL) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LKLSAKDIYEKDFEKTMARGYRREEVDAFLDDIIADYQKMADMNNEVVKL
SEENHKLKKELEELR
Ligand information
>8e2c Chain C (length=7) Species: 93062 (Staphylococcus aureus subsp. aureus COL) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NRLFRKR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e2c Staphylococcus aureus FtsZ and PBP4 bind to the conformationally dynamic N-terminal domain of GpsB
Resolution2.4 Å
Binding residue
(original residue number in PDB)		I13 Y14 K16 E29 D32 D36
Binding residue
(residue number reindexed from 1)		I8 Y9 K11 E24 D27 D31
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8e2c, PDBe:8e2c, PDBj:8e2c
PDBsum8e2c
PubMed38639993
UniProtQ2FYI5|GPSB_STAA8 Cell cycle protein GpsB (Gene Name=gpsB)

[Back to BioLiP]