Structure of PDB 8dzk Chain A Binding Site BS01

Receptor Information
>8dzk Chain A (length=349) Species: 5759 (Entamoeba histolytica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQHIAIVGCVHGKYREMYRQLSEYEKSTGKEISFVICTGDMQTLRYEAD
LVYLKVPPKYKQMGDFHLYYEGKEKAPYLTLFIGGNHESSNVLLHLYNGG
FVCFNMYYLGVCSCININGLRIVGVSGIYKSFDEKKPYTYPPSPNDVVSL
FHTRNYVIQMLSNLSQSSQIDISLSHDWPQGIVMKGNYKQLYRFQPGFKK
DGASLGSPINKVILNTLKPKYWISGHMHCEYHAEEGPTHFIALGKIGYKN
AISYLDLPLKQKTDLEYDKDWVCNLIMTWPAFSNKAQFPDLSYSISELLS
KRTKELDKKIIELWEKYIGLKIIYDSDTFDIQFTSRRFYIEKIYNELNI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dzk Crystal Structure of the RNA Lariat Debranching Enzyme Dbr1 with Hydrolyzed Phosphorothioate RNA Product.
Resolution2.1 Å
Binding residue
(original residue number in PDB)
H16 D45 K59 Y64 N90 H91 K134 F155 H156 G201 D205 H230 M231 H232 K249
Binding residue
(residue number reindexed from 1)
H12 D41 K55 Y60 N86 H87 K130 F151 H152 G197 D201 H226 M227 H228 K245
Enzymatic activity
Enzyme Commision number 3.1.4.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005506 iron ion binding
GO:0008270 zinc ion binding
GO:0008419 RNA lariat debranching enzyme activity
GO:0016787 hydrolase activity
GO:0030145 manganese ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000375 RNA splicing, via transesterification reactions
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8dzk, PDBe:8dzk, PDBj:8dzk
PDBsum8dzk
PubMed36484984
UniProtC4M1P9|DBR1_ENTH1 Lariat debranching enzyme (Gene Name=DBR1)

[Back to BioLiP]