Structure of PDB 8dtu Chain A Binding Site BS01

Receptor Information
>8dtu Chain A (length=113) Species: 9844 (Lama glama) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGGGLVQAGDSLRLSCAASGSTFSGYAMGWYRQAPGKERELVAAITSSGA
STYYADSVRGRFTISRDDAKNTVYLQMNSLKPEDTAVYYCAALDEGYLDY
DSWGQGTQVTVSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dtu Evolution of nanobodies specific for BCL11A.
Resolution2.447 Å
Binding residue
(original residue number in PDB)		R19 L20 S21 C22 F29 Y95 C96 W109 G110 G112 T113
Binding residue
(residue number reindexed from 1)		R13 L14 S15 C16 F23 Y89 C90 W103 G104 G106 T107
External links