Structure of PDB 8ds8 Chain A Binding Site BS01

Receptor Information
>8ds8 Chain A (length=166) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RQLWKWFGKPTQRRGMKGKARKLFYKAIVRGKEMIRIGDCAVFLSAGRPN
LPYIGRIQSMWESWGNNMVVRVKWFYHPEETSPGKQFHLRVSSQRKDFME
RALYQSSHVDENDVQTVSHKCLVVGLEQYEQMLKTKKYQDSEGLYYLAGT
YEPTTGMIFSTDGVPV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ds8 Crystal structure of human TNRC18 BAH domain in complex with H3K9me3 peptide
Resolution1.84 Å
Binding residue
(original residue number in PDB)		L2828 S2829 Y2837 W2858 Y2860 E2864 H2908 D2910 D2913 Q2915 T2916
Binding residue
(residue number reindexed from 1)		L44 S45 Y53 W74 Y76 E80 H108 D110 D113 Q115 T116
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003682 chromatin binding

View graph for
Molecular Function
External links
PDB RCSB:8ds8, PDBe:8ds8, PDBj:8ds8
PDBsum8ds8
PubMed37938770
UniProtO15417|TNC18_HUMAN Trinucleotide repeat-containing gene 18 protein (Gene Name=TNRC18)

[Back to BioLiP]