Structure of PDB 8dnz Chain A Binding Site BS01

Receptor Information
>8dnz Chain A (length=458) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IKFLEVIKPFCVILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFG
IMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEV
GDTPKDRALFNGAQKLFGMIITIGQSIVYVMTGMYGDPSEMGAGICLLIT
IQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVN
TGRGMEFEGAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATIFVF
AVVIYFQGFRYELPIRSTKVRGQIGIYPIKLFYTSNIPIILQSALVSNLY
VISQMLSARFSGNLLVSLLGTWSRAYPVGGLCYYLSPPESFGSVLEDPVH
AVVYIVFMLGSCAFFSKTWIEVSGSSPRDIAKQFKDQGMVINGKRETSIY
RELKKIIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEI
FVKEQSEV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dnz A common mechanism of Sec61 translocon inhibition by small molecules.
Resolution2.57 Å
Binding residue
(original residue number in PDB)		F62 M65 I68 L69 V85 T86 L89 I90 I123 G126 Q127 V130 I292 A296 N300
Binding residue
(residue number reindexed from 1)		F60 M63 I66 L67 V83 T84 L87 I88 I121 G124 Q125 V128 I290 A294 N298
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005048 signal sequence binding
GO:0005262 calcium channel activity
GO:0005515 protein binding
GO:0008320 protein transmembrane transporter activity
GO:0043022 ribosome binding
Biological Process
GO:0006613 cotranslational protein targeting to membrane
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
GO:0006616 SRP-dependent cotranslational protein targeting to membrane, translocation
GO:0006620 post-translational protein targeting to endoplasmic reticulum membrane
GO:0007029 endoplasmic reticulum organization
GO:0015031 protein transport
GO:0031204 post-translational protein targeting to membrane, translocation
GO:0039019 pronephric nephron development
GO:0045047 protein targeting to ER
GO:0045048 protein insertion into ER membrane
GO:0070588 calcium ion transmembrane transport
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005784 Sec61 translocon complex
GO:0005789 endoplasmic reticulum membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8dnz, PDBe:8dnz, PDBj:8dnz
PDBsum8dnz
PubMed37169959
UniProtP61619|S61A1_HUMAN Protein transport protein Sec61 subunit alpha isoform 1 (Gene Name=SEC61A1)

[Back to BioLiP]