Structure of PDB 8dej Chain A Binding Site BS01

Receptor Information
>8dej Chain A (length=220) Species: 882 (Nitratidesulfovibrio vulgaris str. Hildenborough) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TYGIRLRVWGDYACFTRPEMKVERVSYDVMPPSAARGILEAIHWKPAIRW
IVDRIHVLRPIVFDNVRRNEVSSKIPKPNPATAMRDRKPLYFLVDDGSNR
QQRAATLLRNVDYVIEAHFELTDKAGAEDNAGKHLDIFRRRARAGQSFQQ
PCLGCREFPASFELLEGDVPLSCYAGEKRDLGYMLLDIDFERDMTPLFFK
AVMEDDVITPPSRTSPEVRA
Ligand information
>8dej Chain L (length=47) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggauugaaacgccaugcucaggcuggcgagugggcgccacucuccaa
...............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dej Structural snapshots of R-loop formation by a type I-C CRISPR Cascade.
Resolution2.86 Å
Binding residue
(original residue number in PDB)		K28 S40 G44 W51 K52 N76 E77 V78 R107 Q109 F155 P158 C159 G161 R163 F197
Binding residue
(residue number reindexed from 1)		K21 S33 G37 W44 K45 N69 E70 V71 R100 Q102 F148 P151 C152 G154 R156 F190
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8dej, PDBe:8dej, PDBj:8dej
PDBsum8dej
PubMed36805026
UniProtQ72WF9

[Back to BioLiP]