Structure of PDB 8d8i Chain A Binding Site BS01

Receptor Information
>8d8i Chain A (length=201) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTVEDVISQVARAHREIFTRTVQEIWEDFSMSFTPAVREVVEFAKHIPGF
RDLSQHDQVTLLKAGTFEVLMVRFASLFNVKDQTVMFLSRTTYSLQELGA
MGMGDLLSAMFDFSEKLNSLALTEEELGLFTAVVLVSADRSGMENSASVE
QLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNNMHSEKLLSFR
V
Ligand information
>8d8i Chain B (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
THRLITLADHIAQIITQDFA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8d8i Structural basis of synthetic agonist activation of the nuclear receptor REV-ERB.
Resolution2.504 Å
Binding residue
(original residue number in PDB)		Q433 F443 V447 V451 V469 L472 K473 F477 S603 E604 K605 L606 L607 S608 F609 V611
Binding residue
(residue number reindexed from 1)		Q23 F33 V37 V41 V59 L62 K63 F67 S193 E194 K195 L196 L197 S198 F199 V201
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8d8i, PDBe:8d8i, PDBj:8d8i
PDBsum8d8i
PubMed36414641
UniProtP20393|NR1D1_HUMAN Nuclear receptor subfamily 1 group D member 1 (Gene Name=NR1D1)

[Back to BioLiP]