Structure of PDB 8d52 Chain A Binding Site BS01

Receptor Information
>8d52 Chain A (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVMTKEEQIFLLHRAQAQCEKRLKEVLQRPAGRPCLPEWDHILCWPLGAP
GEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKF
L
Ligand information
>8d52 Chain B (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IQDLRRRFFLHHLIAEAHTAE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8d52 Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand containing (2-naphthyl)-beta-3-homoalanine
Resolution2.02 Å
Binding residue
(original residue number in PDB)
M32 K34 E35 I38 D113 H114 I115 I135 Y136 D137 F138 V157 H160 R162 T163 W164 A165 N166 Y167 F173 L174
Binding residue
(residue number reindexed from 1)
M3 K5 E6 I9 D40 H41 I42 I62 Y63 D64 F65 V84 H87 R89 T90 W91 A92 N93 Y94 F100 L101
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8d52, PDBe:8d52, PDBj:8d52
PDBsum8d52
PubMed37587780
UniProtQ03431|PTH1R_HUMAN Parathyroid hormone/parathyroid hormone-related peptide receptor (Gene Name=PTH1R)

[Back to BioLiP]