Structure of PDB 8d51 Chain A Binding Site BS01

Receptor Information
>8d51 Chain A (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTKEEQIFLLHRAQAQCEKRLKEVLQRPAGRPCLPEWDHILCWPLGAPGE
VVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFL
Ligand information
>8d51 Chain B (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QDLRRRFFLHHLIAEWHTAEI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8d51 parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand containing beta-3-homotryptophan
Resolution2.0 Å
Binding residue
(original residue number in PDB)		M32 T33 K34 E35 L41 D113 H114 Y136 D137 F138 V157 R162 T163 W164 A165 N166 Y167 F173 L174
Binding residue
(residue number reindexed from 1)		M1 T2 K3 E4 L10 D38 H39 Y61 D62 F63 V82 R87 T88 W89 A90 N91 Y92 F98 L99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8d51, PDBe:8d51, PDBj:8d51
PDBsum8d51
PubMed37587780
UniProtQ03431|PTH1R_HUMAN Parathyroid hormone/parathyroid hormone-related peptide receptor (Gene Name=PTH1R)

[Back to BioLiP]