Structure of PDB 8czh Chain A Binding Site BS01

Receptor Information
>8czh Chain A (length=157) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMSEEQVAQDTEEVFRSYVFYRHQQEQPADPEMVTLPLQPSSTMGQVGR
QLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWG
RVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHSIARWIAQRGG
WVAALNL
Ligand information
>8czh Chain B (length=23) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
APYLEQVARTLRKIGEEINEALR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8czh Peptides from human BNIP5 and PXT1 and non-native binders of pro-apoptotic BAK can directly activate or inhibit BAK-mediated membrane permeabilization.
Resolution1.3 Å
Binding residue
(original residue number in PDB)		R88 Y89 E92 F93 M96 H99 L100 Y110 I114 S117 L118 N124 G126 F134
Binding residue
(residue number reindexed from 1)		R62 Y63 E66 F67 M70 H73 L74 Y84 I88 S91 L92 N98 G100 F108
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:8czh, PDBe:8czh, PDBj:8czh
PDBsum8czh
PubMed36706751
UniProtQ16611|BAK_HUMAN Bcl-2 homologous antagonist/killer (Gene Name=BAK1)

[Back to BioLiP]