Structure of PDB 8czg Chain A Binding Site BS01

Receptor Information
>8czg Chain A (length=157) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMSEEQVAQDTEEVFRSYVFYRHQQEQPADPEMVTLPLQPSSTMGQVGRQ
LAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGR
VVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHSIARWIAQRGGW
VAALNLG
Ligand information
>8czg Chain E (length=22) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SLLEKLAEELRQLADELNKKFE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8czg Peptides from human BNIP5 and PXT1 and non-native binders of pro-apoptotic BAK can directly activate or inhibit BAK-mediated membrane permeabilization.
Resolution1.99 Å
Binding residue
(original residue number in PDB)		I81 R88 Y89 F93 M96 H99 L100 Y110 I114 S117 L118 N124 W125 G126 R127
Binding residue
(residue number reindexed from 1)		I54 R61 Y62 F66 M69 H72 L73 Y83 I87 S90 L91 N97 W98 G99 R100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:8czg, PDBe:8czg, PDBj:8czg
PDBsum8czg
PubMed36706751
UniProtQ16611|BAK_HUMAN Bcl-2 homologous antagonist/killer (Gene Name=BAK1)

[Back to BioLiP]