Structure of PDB 8czf Chain A Binding Site BS01

Receptor Information
>8czf Chain A (length=161) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMSEEQVAQDTEEVFRSYVFYRHQQEQEAAPADPEMVTLPLQPSSTMGQ
VGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGI
NWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHSIARWIAQ
RGGWVAALNLG
Ligand information
>8czf Chain B (length=22) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SYIDKIADLIRKVAEEINSKLE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8czf Peptides from human BNIP5 and PXT1 and non-native binders of pro-apoptotic BAK can directly activate or inhibit BAK-mediated membrane permeabilization.
Resolution1.3 Å
Binding residue
(original residue number in PDB)		I81 R88 Y89 F93 M96 H99 I114 S117 L118 S121 N124 G126 R127 A130 F134
Binding residue
(residue number reindexed from 1)		I58 R65 Y66 F70 M73 H76 I91 S94 L95 S98 N101 G103 R104 A107 F111
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:8czf, PDBe:8czf, PDBj:8czf
PDBsum8czf
PubMed36706751
UniProtQ16611|BAK_HUMAN Bcl-2 homologous antagonist/killer (Gene Name=BAK1)

[Back to BioLiP]