Structure of PDB 8cz9 Chain A Binding Site BS01

Receptor Information
>8cz9 Chain A (length=108) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FLSCYPWFHGPISRVRAAQLVQLQGPDAHGVFLVRQSESRRGKYVLTFNL
QGRAKHLRLVLTERGQCRVQHLHFPSVVDMLRHFQRSPIPLECGAACDVR
LSGYVVVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cz9 Rare genetic variants in SH2B3 identified in lupus patients breach B cell tolerance and predispose carriers to autoimmunity
Resolution1.65 Å
Binding residue
(original residue number in PDB)		R343 R364 S366 E367 S368 V374 K384 H385 R387 Q399 H400 P419 L420
Binding residue
(residue number reindexed from 1)		R14 R35 S37 E38 S39 V45 K55 H56 R58 Q70 H71 P90 L91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0035591 signaling adaptor activity
Biological Process
GO:0007165 signal transduction

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8cz9, PDBe:8cz9, PDBj:8cz9
PDBsum8cz9
PubMed38417019
UniProtO09039|SH2B3_MOUSE SH2B adapter protein 3 (Gene Name=Sh2b3)

[Back to BioLiP]