Structure of PDB 8cyf Chain A Binding Site BS01

Receptor Information
>8cyf Chain A (length=75) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NWQLQGLCRGMDSSMFFHPDGERGRARTQREQRAKEMCRRCPVIEACRSH
ALEVGEPYGVWGGLSESERDLLLKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cyf Structural basis of DNA binding by the WhiB-like transcription factor WhiB3 in Mycobacterium tuberculosis.
Resolution2.44 Å
Binding residue
(original residue number in PDB)		D35 G36 R38
Binding residue
(residue number reindexed from 1)		D20 G21 R23
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0015035 protein-disulfide reductase activity
GO:0035731 dinitrosyl-iron complex binding
GO:0046872 metal ion binding
GO:0047134 protein-disulfide reductase (NAD(P)H) activity
GO:0051536 iron-sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0019216 regulation of lipid metabolic process
GO:0045454 cell redox homeostasis
GO:0045892 negative regulation of DNA-templated transcription
GO:0071766 Actinobacterium-type cell wall biogenesis
GO:0075137 response to host redox environment
Cellular Component
GO:0005737 cytoplasm
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cyf, PDBe:8cyf, PDBj:8cyf
PDBsum8cyf
PubMed37142222
UniProtP9WF41|WHIB3_MYCTU Redox- and pH-responsive transcriptional regulator WhiB3 (Gene Name=whiB3)

[Back to BioLiP]