Structure of PDB 8cx4 Chain A Binding Site BS01

Receptor Information

>8cx4 Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAP
WIEQEGPEYWDRETQISKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYG
CDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP

Ligand information

>8cx4 Chain C (length=9) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LRVMMLAPF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8cx4 Autoimmunity-associated T cell receptors recognize HLA-B*27-bound peptides.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	Y7 T24 E45 R62 E63 I66 S67 D77 Y84 Y99 Y123 T143 K146 W147 V152 L156 Y159 E163 W167 Y171
Binding residue (residue number reindexed from 1)	Y7 T24 E45 R62 E63 I66 S67 D77 Y84 Y99 Y123 T143 K146 W147 V152 L156 Y159 E163 W167 Y171

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0002474	antigen processing and presentation of peptide antigen via MHC class I

	Cellular Component
GO:0016020	membrane
GO:0030670	phagocytic vesicle membrane
GO:0042612	MHC class I protein complex
GO:0098553	lumenal side of endoplasmic reticulum membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8cx4, PDBe:8cx4, PDBj:8cx4
PDBsum	8cx4
PubMed	36477533
UniProt	A3F718

[Back to BioLiP]