Structure of PDB 8cv6 Chain A Binding Site BS01

Receptor Information
>8cv6 Chain A (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCD
IIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAM
ARKLQDVFEMRFAKMP
Ligand information
>8cv6 Chain B (length=17) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WYDVFLTRKYGKKKVAC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cv6 Peptide 4.2B in complex with BRD4.2
Resolution1.7 Å
Binding residue
(original residue number in PDB)		W374 A384 L385 L387 N433 H437
Binding residue
(residue number reindexed from 1)		W32 A42 L43 L45 N91 H95
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8cv6, PDBe:8cv6, PDBj:8cv6
PDBsum8cv6
PubMed37269828
UniProtO60885|BRD4_HUMAN Bromodomain-containing protein 4 (Gene Name=BRD4)

[Back to BioLiP]