Structure of PDB 8cv5 Chain A Binding Site BS01

Receptor Information
>8cv5 Chain A (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPM
DLSTVKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQD
VFEMRFAKMPDE
Ligand information
>8cv5 Chain B (length=17) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WYDVFLTRKYGKKKVAC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cv5 Peptide 4.2B in complex with BRD3.2
Resolution1.47 Å
Binding residue
(original residue number in PDB)		W332 V338 A342 L343 E344 N391 H395
Binding residue
(residue number reindexed from 1)		W26 V32 A36 L37 E38 N85 H89
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8cv5, PDBe:8cv5, PDBj:8cv5
PDBsum8cv5
PubMed37269828
UniProtQ15059|BRD3_HUMAN Bromodomain-containing protein 3 (Gene Name=BRD3)

[Back to BioLiP]