Structure of PDB 8cti Chain A Binding Site BS01

Receptor Information
>8cti Chain A (length=202) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLRYPVKPEEMDWSELYPEFFQVEFADIGCGYGGLLVELSPLFPDTLILG
LEIRVKVSDYVQDRIRALRAFQNIACLRSNAMKHLPNFFYKGQLTKMFFL
FPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTH
FEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQ
DP
Ligand information
>8cti Chain C (length=71) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguuccauaguguagcgguuaucacgucugcuuuacacgcagaagguccu
ggguucgagccccaguggaac
.<<<<<<..<<<..........>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cti Structural basis of regulated m 7 G tRNA modification by METTL1-WDR4.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		K111 K167 R168 K170 W173
Binding residue
(residue number reindexed from 1)		K56 K107 R108 K110 W113
Enzymatic activity
Enzyme Commision number 2.1.1.-
2.1.1.33: tRNA (guanine(46)-N(7))-methyltransferase.
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008176 tRNA (guanine(46)-N7)-methyltransferase activity
GO:0160090 internal mRNA (guanine-N7-)-methyltransferase activity
Biological Process
GO:0006400 tRNA modification
GO:0008033 tRNA processing
GO:0030488 tRNA methylation
GO:0032259 methylation
GO:0033554 cellular response to stress
GO:0036265 RNA (guanine-N7)-methylation
GO:0036416 tRNA stabilization
GO:0106004 tRNA (guanine-N7)-methylation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005829 cytosol
GO:0043527 tRNA methyltransferase complex
GO:0106143 tRNA (m7G46) methyltransferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cti, PDBe:8cti, PDBj:8cti
PDBsum8cti
PubMed36599985
UniProtQ9UBP6|TRMB_HUMAN tRNA (guanine-N(7)-)-methyltransferase (Gene Name=METTL1)

[Back to BioLiP]