Structure of PDB 8csh Chain A Binding Site BS01

Receptor Information
>8csh Chain A (length=53) Species: 45202 (unidentified plasmid) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKTIKMVADELNVTKQTVVNNAKNLNISFEKENGVNYIDDNDYLKIVEKI
TKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8csh Molecular Analysis of pSK1 par: A Novel Plasmid Partitioning System Encoded by Staphylococcal Multiresistance Plasmids.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		V13 T14 T17 N24
Binding residue
(residue number reindexed from 1)		V13 T14 T17 N24
Enzymatic activity
Enzyme Commision number ?
External links