Structure of PDB 8cqy Chain A Binding Site BS01

Receptor Information
>8cqy Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRINPESPADTCIPKLN
EGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cqy Interactions of the protein tyrosine phosphatase PTPN3 with viral and cellular partners through its PDZ domain: insights into structural determinants and phosphatase activity.
Resolution1.7 Å
Binding residue
(original residue number in PDB)
K20 F21 G22 F23 N24 L25 K26 Q31 S38 H72 D73 V76
Binding residue
(residue number reindexed from 1)
K16 F17 G18 F19 N20 L21 K22 Q27 S34 H68 D69 V72
Enzymatic activity
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
External links
PDB RCSB:8cqy, PDBe:8cqy, PDBj:8cqy
PDBsum8cqy
PubMed37200868
UniProtP26045|PTN3_HUMAN Tyrosine-protein phosphatase non-receptor type 3 (Gene Name=PTPN3)

[Back to BioLiP]