Structure of PDB 8cn3 Chain A Binding Site BS01

Receptor Information
>8cn3 Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQ
IGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPT
Ligand information
>8cn3 Chain C (length=4) Species: 11926 (Human T-cell lymphotrophic virus type 1 (strain ATK)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ETEV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cn3 Identification of small molecule antivirals against HTLV-1 by targeting the hDLG1-Tax-1 protein-protein interaction.
Resolution2.71 Å
Binding residue
(original residue number in PDB)		L24 F26 S27 I28 N34 H79 V83 K87
Binding residue
(residue number reindexed from 1)		L13 F15 S16 I17 N23 H68 V72 K76
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8cn3, PDBe:8cn3, PDBj:8cn3
PDBsum8cn3
PubMed37481039
UniProtQ12959|DLG1_HUMAN Disks large homolog 1 (Gene Name=DLG1)

[Back to BioLiP]