Structure of PDB 8cl1 Chain A Binding Site BS01

Receptor Information

>8cl1 Chain A (length=213) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQ
DLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHMREPRGSDIAGTT
STLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPK
EPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPG
ATLEEMMTACQGV

Ligand information

>8cl1 Chain B (length=14) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PVLFPGQPFGQPPL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8cl1 Two structural switches in HIV-1 capsid regulate capsid curvature and host factor binding.
Resolution	3.35 Å
Binding residue (original residue number in PDB)	N53 L56 N57 M66 Q67 K70 N74 T107
Binding residue (residue number reindexed from 1)	N53 L56 N57 M66 Q67 K70 N74 T99

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0016032	viral process

View graph for
Biological Process

External links

PDB	RCSB:8cl1, PDBe:8cl1, PDBj:8cl1
PDBsum	8cl1
PubMed	37040417
UniProt	P12493\|GAG_HV1N5 Gag polyprotein (Gene Name=gag)

[Back to BioLiP]