Structure of PDB 8ckc Chain A Binding Site BS01

Receptor Information

>8ckc Chain A (length=237) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVRLSMLPHLADLVSYS
IQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMSWS
CGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAIC
LLSPDRPGVQDHVRIEALQDRLCDVLQAYIRIQHPGGRLLYAKMIQKLAD
LRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEV

Ligand information

>8ckc Chain B (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RHKILHRLLQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ckc Structural analysis and biological activities of C25-amino and C25-nitro vitamin D analogs.
Resolution	2.1 Å
Binding residue (original residue number in PDB)	I270 K274 I288 K292 P442 E446 E451 V452
Binding residue (residue number reindexed from 1)	I55 K59 I73 K77 P227 E231 E236 V237

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ckc, PDBe:8ckc, PDBj:8ckc
PDBsum	8ckc
PubMed	37054528
UniProt	Q9PTN2\|VDRA_DANRE Vitamin D3 receptor A (Gene Name=vdra)

[Back to BioLiP]