Structure of PDB 8che Chain A Binding Site BS01

Receptor Information
>8che Chain A (length=214) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMTWVRQAPGKGLVWVGE
INPDSSTINYAPSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCASGV
FTSWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEP
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVD
HKPSNTKVDKRVES
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8che HMB-001: A Novel Bispecific Antibody Accumulating and Targeting Endogenous FVIIa to Activated Platelets for Subcutaneous Prophylaxis in Multiple Bleeding Disorders Including Glanzmann Thrombasthenia.
Resolution1.49 Å
Binding residue
(original residue number in PDB)		V2 F27 Y32 W33 E50 V100 T102
Binding residue
(residue number reindexed from 1)		V2 F27 Y32 W33 E50 V100 T102
External links