Structure of PDB 8c7u Chain A Binding Site BS01

Receptor Information

>8c7u Chain A (length=261) Species: 226185 (Enterococcus faecalis V583) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AMATLLEKTRQVNELLQKNNLFDVQAELPYNKMAMILGDILESNAYIISS
SGDLLGYTEKLDVNNARIKNMFKEKKFPQGYTEAVDMLKVTEANIPIDSD
LTAFPFESRELYPFGLTTIVPLYGAGKRLGTIILARVEKSFNEDDLVLAE
YSATVVGMQILYHQSRTIEAEVRSATAVQMAINTLSYSELKAVHAIFEAL
DGEEGRLTASSIADEIGITRSVIVNALRKLESAGIIESRSLGMKGTYLKV
LNQQFIKELEK

Ligand information

>8c7u Chain E (length=29) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

taaattttctgaaaattctgaaaattatc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8c7u Structural insights into CodY activation and DNA recognition.
Resolution	3.15 Å
Binding residue (original residue number in PDB)	S185 S187 T218 S220 S239 L240 G241 M242 K243
Binding residue (residue number reindexed from 1)	S186 S188 T219 S221 S240 L241 G242 M243 K244

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0005525	GTP binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0045892	negative regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8c7u, PDBe:8c7u, PDBj:8c7u
PDBsum	8c7u
PubMed	37326020
UniProt	Q834K5

[Back to BioLiP]