Structure of PDB 8c3h Chain A Binding Site BS01

Receptor Information

>8c3h Chain A (length=104) Species: 55518 (Magnetospirillum gryphiswaldense) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SIFRCRQCGQTISRRDWLLPMGGDHEHVVFNPAGMIFRVWCFSLAQGLRL
IGAPSGEFSWFKGYDWTIALCGQCGSHLGWHYEGGSQPQTFFGLIKDRLA
EGPA

Ligand information

>8c3h Chain D (length=7) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

FFEQMQN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8c3h Cereblon neo-substrate binding mimics the recognition of the cyclic imide degron.
Resolution	1.71 Å
Binding residue (original residue number in PDB)	N50 F77 W79 W85 H96 W99 Y101
Binding residue (residue number reindexed from 1)	N31 F58 W60 W66 H77 W80 Y82

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:8c3h, PDBe:8c3h, PDBj:8c3h
PDBsum	8c3h
PubMed	36701892
UniProt	A4TVL0

[Back to BioLiP]