Structure of PDB 8bzm Chain A Binding Site BS01

Receptor Information
>8bzm Chain A (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKPPFSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSI
RHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bzm FOXK1-ELF1_heterodimer bound to DNA
Resolution2.69 Å
Binding residue
(original residue number in PDB)		S309 Y310 N351 H355 R397
Binding residue
(residue number reindexed from 1)		S6 Y7 N48 H52 R94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8bzm, PDBe:8bzm, PDBj:8bzm
PDBsum8bzm
PubMed
UniProtP85037|FOXK1_HUMAN Forkhead box protein K1 (Gene Name=FOXK1)

[Back to BioLiP]