Structure of PDB 8bx1 Chain A Binding Site BS01

Receptor Information
>8bx1 Chain A (length=127) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMDMKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTI
SRFEALQLSLKNMSKLRPLLEKWVEEADNNRVRWSLETMFLKSPKPSLQQ
ITHIANQLGLEKDVVRVWFSNRRQKGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bx1 Crystal structure of Oct4-Soc2-HoxB1 complex
Resolution2.5 Å
Binding residue
(original residue number in PDB)		S43 T45 T46 R49 S56 N59 Q146
Binding residue
(residue number reindexed from 1)		S46 T48 T49 R52 S59 N62 Q124
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8bx1, PDBe:8bx1, PDBj:8bx1
PDBsum8bx1
PubMed
UniProtP20263|PO5F1_MOUSE POU domain, class 5, transcription factor 1 (Gene Name=Pou5f1)

[Back to BioLiP]