Structure of PDB 8bv7 Chain A Binding Site BS01

Receptor Information
>8bv7 Chain A (length=95) Species: 287889 (Trichoplax sp. H2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLGSEVIQALIFKDDGSLGLSISGGVGSSSFKSGDDGIFVSKIAKGGPCD
NEGTLKIGDKILSVNEISFTGITHEKAVEILKNQDSKYMVVVERS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bv7 Crystal structure of Trichoplax Scribble PDZ1 domain in complex with Trichoplax the phosphorylated Vangl peptide
Resolution1.8 Å
Binding residue
(original residue number in PDB)		S13 L14 L16 S17 I18 S24 S25 S37 H70 V74
Binding residue
(residue number reindexed from 1)		S17 L18 L20 S21 I22 S28 S29 S41 H74 V78
Enzymatic activity
Enzyme Commision number ?
External links