Structure of PDB 8br9 Chain A Binding Site BS01

Receptor Information
>8br9 Chain A (length=212) Species: 2261 (Pyrococcus furiosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPP
EEGGLNGSAMYIDTENTFRPERLREIAQNRGLDPDEVLDNVAYARAFNSN
HQMQLLYQASAMMVESLNTDRPYKLLIVDSLTSHFRSEYIGRGALAERQQ
KLARFLRMLHRLANEFDIAVFVTNQTLRVYLRKGKRIARLIDAPHLPEGE
AVFSITEKGIED
Ligand information
>8br9 Chain B (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KLNVSCQALQKACKLFSDSGFSTASGK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8br9 A Recombinant Approach For Stapled Peptide Discovery Yields Inhibitors of the RAD51 Recombinase
Resolution1.63 Å
Binding residue
(original residue number in PDB)		L197 D198 V200 A201 Y202 A203 H210 L214 Y216 Q217 S219 M221 M267 R270 L271
Binding residue
(residue number reindexed from 1)		L88 D89 V91 A92 Y93 A94 H101 L105 Y107 Q108 S110 M112 M158 R161 L162
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016887 ATP hydrolysis activity
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006310 DNA recombination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8br9, PDBe:8br9, PDBj:8br9
PDBsum8br9
PubMed38075664
UniProtO74036|RADA_PYRFU DNA repair and recombination protein RadA (Gene Name=radA)

[Back to BioLiP]